PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID e_gw1.16.00.288.1
Common NameOT_ostta16g01090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family MYB
Protein Properties Length: 119aa    MW: 13616.5 Da    PI: 9.9879
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
e_gw1.16.00.288.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89.2e-171965248
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       + W + Ede l+++++++G ++W+ Ia+ m+ gR +kqc++r++++l
  e_gw1.16.00.288.1 19 QQWRKHEDEELLQLIAKHGAKRWSYIASLMPGGRRGKQCRDRYLNHL 65
                       68*******************************************97 PP

2Myb_DNA-binding51.91.7e-1672113245
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        g WTteE+++lv+++k lG++ W++ a+ ++ gR ++ +k++w+
  e_gw1.16.00.288.1  72 GEWTTEEEQILVEGHKALGTK-WAALAKLLP-GRPENAIKNHWH 113
                        68*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.3071365IPR017930Myb domain
SMARTSM007175.3E-131767IPR001005SANT/Myb domain
SuperFamilySSF466891.83E-2717112IPR009057Homeodomain-like
PfamPF002492.1E-141965IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-232072IPR009057Homeodomain-like
CDDcd001671.26E-112165No hitNo description
PROSITE profilePS5129420.6666119IPR017930Myb domain
SMARTSM007172.9E-1170118IPR001005SANT/Myb domain
PfamPF002493.0E-1472113IPR001005SANT/Myb domain
CDDcd001671.13E-973113No hitNo description
Gene3DG3DSA:1.10.10.609.1E-1973118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0016787Molecular Functionhydrolase activity
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
MDLPSTSDPE NANSRGISQQ WRKHEDEELL QLIAKHGAKR WSYIASLMPG GRRGKQCRDR  60
YLNHLRPGIV IGEWTTEEEQ ILVEGHKALG TKWAALAKLL PGRPENAIKN HWHATMRCK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-33171193104MYB PROTO-ONCOGENE PROTEIN
1h88_C8e-331311953158MYB PROTO-ONCOGENE PROTEIN
1h89_C8e-331311953158MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-33171193104C-Myb DNA-Binding Domain
1msf_C3e-33171193104C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003083558.11e-85myb-like protein (ISS)
SwissprotQ9S7L24e-35MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A096P8H87e-83A0A096P8H8_
STRINGQ00UE24e-85(Ostreococcus tauri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1516114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.13e-36myb domain protein 98
Publications ? help Back to Top
  1. Derelle E, et al.
    Genome analysis of the smallest free-living eukaryote Ostreococcus tauri unveils many unique features.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(31): p. 11647-52
    [PMID:16868079]